PDB entry 1hj1

View 1hj1 on RCSB PDB site
Description: rat oestrogen receptor beta ligand-binding domain in complex with pure antioestrogen ici164,384
Deposited on 2001-01-08, released 2002-01-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-01-04, with a file datestamp of 2002-01-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21966
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hj1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hj1A (A:)
    lspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfvel
    slldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvia
    ksgissqqqsvrlanllmllshvrhisnkgmehllsmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hj1A (A:)
    lspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfvel
    slldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssrklthllnavtdalvwviaksgissqqqsvrla
    nllmllshvrhisnkgmehllsmk