PDB entry 1him

View 1him on RCSB PDB site
Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition
Deposited on 1992-07-08, released 1994-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.2
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1himH (H:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1himJ (J:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1himL (L:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1himL (L:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1himM (M:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1himM (M:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
    ssvtvtsstwpsqsitcnvahpasstkvdkkiepr