PDB entry 1hhl

View 1hhl on RCSB PDB site
Description: the three-dimensional structure of pheasant and guinea-fowl egg lysozymes
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-05-04, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guinea fowl lysozyme
    Species: Numida meleagris [TaxId:8996]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hhla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hhlA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgdgmnawvawrkhckgtdv
    rvwikgcrl