PDB entry 1hh2

View 1hh2 on RCSB PDB site
Description: crystal structure of nusa from thermotoga maritima
Deposited on 2000-12-18, released 2001-10-19
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-27, with a file datestamp of 2001-11-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2439
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh2P (P:)
    mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
    llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
    lekekqfekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkv
    yiidvvkttkgpkilvsrrvpefviglmkleipevengiveikaiarepgvrtkvavasn
    dpnvdpigacigeggsriaailkelkgekldvlkwsddpkqlianalapatvieveildk
    enkaarvlvpptqlslaigkggqnarlaakltgwkidikpimnl