PDB entry 1hg5

View 1hg5 on RCSB PDB site
Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Deposited on 2000-12-12, released 2001-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-12, with a file datestamp of 2001-02-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19286
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hg5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hg5A (A:)
    gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
    litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
    rqvafdftkvkrgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafm
    llfkdairlfaaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvg
    idrgdipdlsqapsslldaleqh