PDB entry 1hfs

View 1hfs on RCSB PDB site
Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the n-carboxy-alkyl inhibitor l-764,004
Class: hydrolase
Keywords: hydrolase, metalloprotease, matrix metalloprotease-3, proteoglycanase
Deposited on 1997-02-13, released 1998-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stromelysin-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08254 (0-159)
  Domains in SCOPe 2.08: d1hfsa_
• Heterogens: ZN, CA, L04, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hfsA (A:)
  gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
  vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
  glfhsantealmyplyhsltdltrfrlsqddingiqslyg