PDB entry 1hem

View 1hem on RCSB PDB site
Description: structural and thermodynamic analysis of compensating mutations within the core of chicken egg white lysozyme
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1992-01-10, released 1993-10-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.14
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hen egg white lysozyme
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • conflict (90)
    Domains in SCOPe 2.01: d1hema_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hemA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl