PDB entry 1hef

View 1hef on RCSB PDB site
Description: the crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1992-09-21, released 1994-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03366 (0-98)
    • conflict (35)
  Domains in SCOP 1.73: d1hefe_
• Chain 'I':
  Compound: skf 108738
  
• Heterogens: PHE, OHE, OME, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hefE (E:)
  pqitlwqrplvtikiggqlkealldtgaddtvleenslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'I':
  No sequence available.