PDB entry 1hef

View 1hef on RCSB PDB site
Description: the crystal structures at 2.2 angstroms resolution of hydroxyethylene- based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
Deposited on 1992-09-21, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d1hefe_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hefE (E:)
    pqitlwqrplvtikiggqlkealldtgaddtvleenslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf