PDB entry 1hdm

View 1hdm on RCSB PDB site
Description: histocompatibility antigen hla-dm
Class: immune system
Keywords: histocompatibility protein, immune system
Deposited on 1998-09-09, released 1999-09-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (class II histocompatibility antigen, m alpha chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28067
      • conflict (178)
    Domains in SCOPe 2.02: d1hdma1, d1hdma2
  • Chain 'B':
    Compound: protein (class II histocompatibility antigen, m beta chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hdmb1, d1hdmb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hdmA (A:)
    vpeaptpmwpddlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefa
    dwaqeqgdailfdkefcewmiqqipkldgkipvsrgfpiaevftlkplefgkpntlvcfv
    snlfppmltvnwhdhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivthepd
    rytaiaywvprnalpsdllen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hdmA (A:)
    lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
    dkefcewmiqqipkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppmltvnw
    hdhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivthepdrytaiaywvprn
    alps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hdmB (B:)
    ggfvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqk
    dtlmqrlnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgfypae
    vtitwrkngklvmhssahktaqpngdwtyqtlshlaltpsygdtytcvvehigapepilr
    dwtpglspmqtlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hdmB (B:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt
    lmqrlnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgfypaevt
    itwrkngklvmhssahktaqpngdwtyqtlshlaltpsygdtytcvvehigapepilrdw
    tpg