PDB entry 1hdm

View 1hdm on RCSB PDB site
Description: histocompatibility antigen hla-dm
Deposited on 1998-09-09, released 1999-09-10
The last revision prior to the SCOP 1.65 freeze date was dated 1999-09-10, with a file datestamp of 1999-09-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hdmA (A:)
    vpeaptpmwpddlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefa
    dwaqeqgdailfdkefcewmiqqipkldgkipvsrgfpiaevftlkplefgkpntlvcfv
    snlfppmltvnwhdhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivthepd
    rytaiaywvprnalpsdllen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hdmA (A:)
    lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
    dkefcewmiqqipkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppmltvnw
    hdhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivthepdrytaiaywvprn
    alps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hdmB (B:)
    ggfvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqk
    dtlmqrlnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgfypae
    vtitwrkngklvmhssahktaqpngdwtyqtlshlaltpsygdtytcvvehigapepilr
    dwtpglspmqtlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hdmB (B:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt
    lmqrlnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgfypaevt
    itwrkngklvmhssahktaqpngdwtyqtlshlaltpsygdtytcvvehigapepilrdw
    tpg