PDB entry 1hdm

View 1hdm on RCSB PDB site
Description:
Deposited on 1998-09-09, released 1999-09-10
The last revision prior to the SCOP 1.63 freeze date was dated 1999-09-10, with a file datestamp of 1999-09-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hdma1, d1hdma2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1hdmb1, d1hdmb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdmA (A:)
    lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
    dkefcewmiqqipkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppmltvnw
    hdhsvpvegfgptfvsavdglsfqafsylnftpepsdifscivthepdrytaiaywvprn
    alps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdmB (B:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt
    lmqrlnglqncathtqpfwgsltnrtrppsvqvakttpfntrepvmlacyvwgfypaevt
    itwrkngklvmhssahktaqpngdwtyqtlshlaltpsygdtytcvvehigapepilrdw
    tpg