PDB entry 1hdj

View 1hdj on RCSB PDB site
Description: human hsp40 (hdj-1), nmr
Class: molecular chaperone
Keywords: molecular chaperone
Deposited on 1996-05-09, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human hsp40
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25685 (0-75)
  Domains in SCOPe 2.07: d1hdja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hdjA (A:)
  mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
  reifdrygeeglkgsgc