PDB entry 1hdj

View 1hdj on RCSB PDB site
Description: human hsp40 (hdj-1), nmr
Class: molecular chaperone
Keywords: molecular chaperone
Deposited on 1996-05-09, released 1996-11-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human hsp40
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hdja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdjA (A:)
    mgkdyyqtlglargasdeeikrayrrqalryhpdknkepgaeekfkeiaeaydvlsdprk
    reifdrygeeglkgsgc