PDB entry 1hdg

View 1hdg on RCSB PDB site
Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution
Deposited on 1995-01-17, released 1995-03-31
The last revision prior to the SCOP 1.71 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdgO (O:)
    arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
    tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
    apakgeditvvigcnedqlkpehtiiscascttnsiapivkvlhekfgivsgmlttvhsy
    tndqrvldlphkdlrraraaavniiptttgaakavalvvpevkgkldgmairvptpdgsi
    tdltvlvekettveevnavmkeategrlkgiigyndepivssdiigttfsgifdatitnv
    iggklvkvaswydneygysnrvvdtlelllkm
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hdgQ (Q:)
    arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
    tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
    apakgeditvvigcnedqlkpehtiiscascttnsiapivkvlhekfgivsgmlttvhsy
    tndqrvldlphkdlrraraaavniiptttgaakavalvvpevkgkldgmairvptpdgsi
    tdltvlvekettveevnavmkeategrlkgiigyndepivssdiigttfsgifdatitnv
    iggklvkvaswydneygysnrvvdtlelllkm