PDB entry 1hd3

View 1hd3 on RCSB PDB site
Description: a-spectrin sh3 domain f52y mutant
Deposited on 2000-11-06, released 2001-11-01
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-26, with a file datestamp of 2002-04-26.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.245
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1hd3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hd3A (A:)
    gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgyvpaayvkkld