PDB entry 1hd1

View 1hd1 on RCSB PDB site
Description: heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr
Deposited on 1999-05-18, released 2000-05-18
The last revision prior to the SCOP 1.63 freeze date was dated 2000-05-18, with a file datestamp of 2000-05-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1hd1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hd1A (A:)
    kmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvmdq
    kehklngkvidpkra