PDB entry 1hd0

View 1hd0 on RCSB PDB site
Description: heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr
Class: RNA binding protein
Keywords: RNA-binding domain, RNA binding protein
Deposited on 1999-05-18, released 2000-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (heterogeneous nuclear ribonucleoprotein d0)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14103 (0-74)
  Domains in SCOPe 2.08: d1hd0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hd0A (A:)
  kmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvmdq
  kehklngkvidpkra