PDB entry 1hcy

View 1hcy on RCSB PDB site
Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-05-15, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.221
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcya1, d1hcya2, d1hcya3
  • Chain 'B':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcyb1, d1hcyb2, d1hcyb3
  • Chain 'C':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcyc1, d1hcyc2, d1hcyc3
  • Chain 'D':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcyd1, d1hcyd2, d1hcyd3
  • Chain 'E':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcye1, d1hcye2, d1hcye3
  • Chain 'F':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254 (0-End)
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hcyf1, d1hcyf2, d1hcyf3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hcyA (A:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyA (A:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hcyB (B:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyB (B:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hcyC (C:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyC (C:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hcyD (D:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyD (D:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1hcyE (E:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyE (E:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1hcyF (F:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcyF (F:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqc
    gvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl