PDB entry 1hcv

View 1hcv on RCSB PDB site
Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)
Deposited on 1996-07-13, released 1997-07-23
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.243
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1hcv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1hcv_ (-)
    dvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hcv_ (-)
    vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss