PDB entry 1hcv

View 1hcv on RCSB PDB site
Description: llama heavy chain variable domain against alpha subunit of hcg (human chorionic gonadotropin)
Deposited on 1996-07-13, released 1997-07-23
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.243
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1hcv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hcv_ (-)
    vqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyya
    ssvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss