PDB entry 1hc2

View 1hc2 on RCSB PDB site
Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
Deposited on 1991-05-15, released 1994-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.2 Å
R-factor: 0.201
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1hc2_ (-)
    tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
    lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
    hsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqrvayf
    gedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvd
    elhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgy
    itdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlp
    pgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidgelit
    ffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfriflcp
    iednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslkeqad
    navngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghngghdygg
    thaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hc2_ (-)
    tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
    lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
    hsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedi
    gmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhw
    driiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitds
    dghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvm
    ehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidgelitffde
    fqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfriflcpiedn
    ngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslkeqadnavn
    ggldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqcgvhgeaypdn
    rplgyplerripdervidgvsnikhvvvkivhhl