PDB entry 1hc1

View 1hc1 on RCSB PDB site
Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-05-15, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.201
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
    Domains in SCOPe 2.04: d1hc1a1, d1hc1a2, d1hc1a3
  • Chain 'B':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
  • Chain 'C':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
  • Chain 'D':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
  • Chain 'E':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
  • Chain 'F':
    Compound: arthropodan hemocyanin
    Species: Panulirus interruptus [TaxId:6735]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04254
      • conflict (31)
      • conflict (162)
      • conflict (457)
      • conflict (513)
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hc1A (A:)
    dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
    ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
    vsvihsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsftgtkknreqr
    vayfgedigmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwl
    dpvdelhwdriiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheai
    dhgyitdsdghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgk
    fnlppgvmehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidg
    elitffdefqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfri
    flcpiednngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslk
    eqadnavngghdldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghnggh
    dyggthaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvkivhhlehhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hc1A (A:)
    tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
    lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
    hsklgdgivlpplyqitphmftnsevidkaysakmtqkpgtfnvsfknreqrvayfgedi
    gmnihhvtwhmdfpfwwedsygyhldrkgelffwvhhqltarfdferlsnwldpvdelhw
    driiregfapltsykyggefpvrpdnihfedvdgvahvhdleitesriheaidhgyitds
    dghtidirqpkgiellgdiiesskyssnvqyygslhntahvmlgrqgdphgkfnlppgvm
    ehfetatrdpsffrlhkymdnifkkhtdsfppythdnlefsgmvvngvaidgelitffde
    fqyslinavdsgeniedveinarvhrlnhneftykitmsnnndgerlatfriflcpiedn
    ngitltldearwfcieldkffqkvpsgpetiersskdssvtvpdmpsfqslkeqadnavn
    ggldlsayerscgipdrmllpkskpegmefnlyvavtdgdkdteghhaqcgvhgeaypdn
    rplgyplerripdervidgvsnikhvvvkivhhl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.