PDB entry 1hbr

View 1hbr on RCSB PDB site
Description: r-state form of chicken hemoglobin d
Class: oxygen storage/transport
Keywords: hemoglobin d (r-state) 1, hemoglobin, avian, high cooperatiity, oxygen transport
Deposited on 1998-12-06, released 1999-03-26
The last revision prior to the SCOP 1.75 freeze date was dated 2000-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin d)
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hbra_
  • Chain 'B':
    Compound: protein (hemoglobin d)
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hbrb_
  • Chain 'C':
    Compound: protein (hemoglobin d)
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hbrc_
  • Chain 'D':
    Compound: protein (hemoglobin d)
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hbrd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrA (A:)
    mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
    kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
    vhaafdkflsavsavlaekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hbrB (B:)
    vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
    dftpecqaawqklvrvvahalarkyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hbrB (B:)
    vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
    dftpecqaawqklvrvvahalark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrC (C:)
    mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
    kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
    vhaafdkflsavsavlaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrD (D:)
    vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
    dftpecqaawqklvrvvahalarkyh