PDB entry 1hbr

View 1hbr on RCSB PDB site
Description: r-state form of chicken hemoglobin d
Deposited on 1998-12-06, released 1999-03-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hbra_
  • Chain 'B':
    Domains in SCOP 1.55: d1hbrb_
  • Chain 'C':
    Domains in SCOP 1.55: d1hbrc_
  • Chain 'D':
    Domains in SCOP 1.55: d1hbrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrA (A:)
    mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
    kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
    vhaafdkflsavsavlaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrB (B:)
    vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
    dftpecqaawqklvrvvahalark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrC (C:)
    mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk
    kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe
    vhaafdkflsavsavlaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbrD (D:)
    vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
    rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
    dftpecqaawqklvrvvahalarkyh