PDB entry 1hbh

View 1hbh on RCSB PDB site
Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect
Deposited on 1995-02-22, released 1995-04-20
The last revision prior to the SCOP 1.67 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1hbha_
  • Chain 'B':
    Domains in SCOP 1.67: d1hbhb_
  • Chain 'C':
    Domains in SCOP 1.67: d1hbhc_
  • Chain 'D':
    Domains in SCOP 1.67: d1hbhd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhC (C:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbhD (D:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh