PDB entry 1hbg

View 1hbg on RCSB PDB site
Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-02-11, released 1992-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.146
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin (carbonmonoxy)
  Species: Glycera dibranchiata
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02216 (0-146)
    • conflict (28)
  Domains in SCOP 1.75: d1hbga_
• Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hbgA (A:)
  glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
  kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
  kmnaaakdawaaayadisgalisglqs