PDB entry 1hbg

View 1hbg on RCSB PDB site
Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-02-11, released 1992-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.146
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (carbonmonoxy)
    Species: Glycera dibranchiata
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02216 (0-146)
      • conflict (28)
    Domains in SCOP 1.73: d1hbga_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hbgA (A:)
    glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
    kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs