PDB entry 1haf

View 1haf on RCSB PDB site
Description: heregulin-alpha epidermal growth factor-like domain, nmr, minimized average structure
Class: growth factor
Keywords: growth factor
Deposited on 1995-11-30, released 1996-07-11
The last revision prior to the SCOP 1.75 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heregulin-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hafa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hafA (A:)
    shlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqekae
    ely