PDB entry 1ha5

View 1ha5 on RCSB PDB site
Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for MHC class II recognition.
Class: toxin
Keywords: toxin, molecular recognition, superantigen, exotoxin, zinc binding
Deposited on 2001-03-28, released 2002-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.214
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptococcal pyogenic exotoxin a1
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ha5a1, d1ha5a2
  • Chain 'B':
    Compound: streptococcal pyogenic exotoxin a1
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ha5b1, d1ha5b2
  • Chain 'C':
    Compound: streptococcal pyogenic exotoxin a1
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ha5c1, d1ha5c2
  • Chain 'D':
    Compound: streptococcal pyogenic exotoxin a1
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ha5d1, d1ha5d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5A (A:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5B (B:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5C (C:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha5D (D:)
    dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
    knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhagnhleipkkivvkvs
    idgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknkesf
    wfdffpepeftqskylmiykdnetldsntsqievyltt