PDB entry 1ha3

View 1ha3 on RCSB PDB site
Description: elongation factor tu in complex with aurodox
Class: translation
Keywords: translation, gtpase, aurodox, n-methyl-kirromycin, antibiotic, ribosome
Deposited on 2001-03-26, released 2001-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TUFB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07157 (Start-404)
      • variant tufb (5)
      • variant tufb (32)
      • variant tufb (34)
      • variant tufb (263)
    Domains in SCOPe 2.06: d1ha3a1, d1ha3a2, d1ha3a3
  • Chain 'B':
    Compound: elongation factor tu
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TUFB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07157 (Start-404)
      • variant tufb (5)
      • variant tufb (32)
      • variant tufb (34)
      • variant tufb (263)
    Domains in SCOPe 2.06: d1ha3b1, d1ha3b2, d1ha3b3
  • Heterogens: GDP, MG, MAU, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ha3A (A:)
    akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ha3A (A:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidktahveyetak
    rhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvf
    mnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgene
    wvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeve
    ivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpgsitpht
    kfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvel
    ikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ha3B (B:)
    akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    qmhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreever
    gqvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ha3B (B:)
    gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnahveyetakrhyshvdcpgha
    dyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpel
    ldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldai
    deyiptpvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktv
    vtgvemhrktlqegiagdnvgvllrgvsreevergqvlakpgsitphtkfeasvyvlkke
    eggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftvelikpvaleeglrf
    aireggrtvgagvvtkile