PDB entry 1h9o

View 1h9o on RCSB PDB site
Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, crystal structure at 1.79 a
Class: transferase/receptor
Keywords: transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, sh2 domain, signal transduction, phosphoinositide 3-kinase
Deposited on 2001-03-14, released 2001-03-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H9O (0-3)
    • Uniprot P27986 (4-End)
    Domains in SCOPe 2.05: d1h9oa_
  • Chain 'B':
    Compound: beta-platelet-derived growth factor receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h9oA (A:)
    gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
    nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h9oA (A:)
    gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
    nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaq
    

  • Chain 'B':
    No sequence available.