PDB entry 1h9o

View 1h9o on RCSB PDB site
Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, crystal structure at 1.79 a
Class: transferase/receptor
Keywords: transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, sh2 domain, signal transduction, phosphoinositide 3-kinase
Deposited on 2001-03-14, released 2001-03-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphatidylinositol 3-kinase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1H9O (0-3)
  • Uniprot P27986 (4-End)
  Domains in SCOPe 2.03: d1h9oa_
• Chain 'B':
  Compound: beta-platelet-derived growth factor receptor
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09619 (0-4)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1h9oA (A:)
  gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
  nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1h9oA (A:)
  gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
  nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaq
  

  
  
• Chain 'B':
  No sequence available.