PDB entry 1h9o

View 1h9o on RCSB PDB site
Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, crystal structure at 1.79 a
Deposited on 2001-03-14, released 2001-03-19
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-19, with a file datestamp of 2001-03-19.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.168
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1h9oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h9oA (A:)
  gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
  nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya