PDB entry 1h92

View 1h92 on RCSB PDB site
Description: sh3 domain of human lck tyrosine kinase
Class: transferase
Keywords: transferase, sh3 domain, tyrosine kinase, signal transduction, lck
Deposited on 2001-02-22, released 2001-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (0-62)
      • conflict (0)
    Domains in SCOPe 2.07: d1h92a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h92A (A:)
    gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
    kan