PDB entry 1h8s

View 1h8s on RCSB PDB site
Description: three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
Class: anti-ampicillin antibodies
Keywords: anti-ampicillin antibodies
Deposited on 2001-02-15, released 2001-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mutant al2 6e7p9g
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H8S
    Domains in SCOPe 2.06: d1h8sa1, d1h8sa2
  • Chain 'B':
    Compound: mutant al2 6e7p9g
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H8S
    Domains in SCOPe 2.06: d1h8sb1, d1h8sb2
  • Heterogens: AIC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8sA (A:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrggggsgggg
    sggggsggggsqvqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewig
    niypsdsytnynqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvt
    vsaasgahhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8sA (A:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrqvqlqepggelv
    rpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfkdkatltv
    dkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h8sB (B:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrggggsgggg
    sggggsggggsqvqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewig
    niypsdsytnynqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvt
    vsaasgahhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8sB (B:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrgvqlqepggelv
    rpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfkdkatltv
    dkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa