PDB entry 1h8s

View 1h8s on RCSB PDB site
Description: three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.
Deposited on 2001-02-15, released 2001-08-02
The last revision prior to the SCOP 1.65 freeze date was dated 2001-11-27, with a file datestamp of 2001-11-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h8sA (A:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrggggsgggg
    sggggsggggsqvqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewig
    niypsdsytnynqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvt
    vsaasgahhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8sA (A:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrqvqlqepggelv
    rpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfkdkatltv
    dkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h8sB (B:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrggggsgggg
    sggggsggggsqvqlqepggelvrpgasvklsckasgytftsywinwvkqrpgqglewig
    niypsdsytnynqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvt
    vsaasgahhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h8sB (B:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrgvqlqepggelv
    rpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytnynqkfkdkatltv
    dkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa