PDB entry 1h8f

View 1h8f on RCSB PDB site
Description: glycogen synthase kinase 3 beta.
Deposited on 2001-02-05, released 2002-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-31, with a file datestamp of 2002-01-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1h8fa_
  • Chain 'B':
    Domains in SCOP 1.59: d1h8fb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h8fA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h8fB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari