PDB entry 1h8c

View 1h8c on RCSB PDB site
Description: ubx domain from human faf1
Deposited on 2001-02-01, released 2001-02-13
The last revision prior to the SCOP 1.71 freeze date was dated 2001-06-07, with a file datestamp of 2001-06-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h8ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h8cA (A:)
naepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqld
pnksllevklfpqetlfleake