PDB entry 1h85

View 1h85 on RCSB PDB site
Description: ferredoxin:nadp+ reductase mutant with val 136 replaced by leu (v136l)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, nadp, electron transport
Deposited on 2001-01-24, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp reductase
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (0-294)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d1h85a1, d1h85a2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h85A (A:)
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgplgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety