PDB entry 1h7v

View 1h7v on RCSB PDB site
Description: Rubredoxin from Guillardia Theta
Class: electron transport
Keywords: electron transport, rubredoxin, guillardia theta, zinc- substitution, dipolar couplings
Deposited on 2001-01-16, released 2002-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: GUILLARDIA THETA [TaxId:55529]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1h7va_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h7vA (A:)
    meidegkyeceacgyiyepekgdkfagippgtpfvdlsdsfmcpacrspknqfksikkvi