PDB entry 1h7s

View 1h7s on RCSB PDB site
Description: n-terminal 40kda fragment of human pms2
Class: DNA repair
Keywords: ghl ATPase, mismatch repair, hnpcc
Deposited on 2001-07-10, released 2001-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pms1 protein homolog 2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54278 (Start-364)
      • modified residue (135)
      • modified residue (183)
      • modified residue (311)
      • modified residue (361)
    Domains in SCOP 1.75: d1h7sa1, d1h7sa2
  • Chain 'B':
    Compound: pms1 protein homolog 2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54278 (Start-364)
      • modified residue (135)
      • modified residue (183)
      • modified residue (311)
      • modified residue (361)
    Domains in SCOP 1.75: d1h7sb1, d1h7sb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h7sA (A:)
    meraessstepakaikpidrksvhqicsgqvvlslstavkelvensldagatnidlklkd
    ygvdlievsdngcgveeenfegltlkhhtskiqefadltqvetfgfrgealsslcalsdv
    tistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefqrnikke
    yakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqkqlqsli
    pfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinrrpcdpa
    kvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeeklllavlktsli
    gmfds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7sA (A:)
    gqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltladl
    tqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvs
    vqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctg
    gspsikenigsvfgqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcth
    gvgrsstdrqfffinrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqil
    lqeeklllavlktsligmfds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h7sB (B:)
    meraessstepakaikpidrksvhqicsgqvvlslstavkelvensldagatnidlklkd
    ygvdlievsdngcgveeenfegltlkhhtskiqefadltqvetfgfrgealsslcalsdv
    tistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefqrnikke
    yakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqkqlqsli
    pfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinrrpcdpa
    kvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeeklllavlktsli
    gmfds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h7sB (B:)
    lslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlgealssl
    calsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefq
    rnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvfgqk
    qlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfffinr
    rpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdillqeeklllavlktsligmf
    ds