PDB entry 1h6z

View 1h6z on RCSB PDB site
Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
Class: transferase
Keywords: transferase, kinase, tropical parasite, trypanosome
Deposited on 2001-06-29, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate phosphate dikinase
    Species: TRYPANOSOMA BRUCEI [TaxId:5691]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6za4, d1h6za5, d1h6za6
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6zA (A:)
    mvakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqete
    tipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmpgmmdtvlnlglnkvt
    vdawvrraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltas
    dlkelcdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgt
    avnvqamvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhsl
    slrwakahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlw
    llqcrngkrtihaavriaidmvneglisreeavlridpyqvdhlmhpnlepgaekankpi
    grglaaspgaavgqvvfdaesakewsgrgkkvimvrletspedlagmdaacgiltarggm
    tshaavvargmgkccvsgcgdmvirgksfklngsvfregdyitidgskgliyagklklrs
    pdlkgsfqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsrinf
    iremiladsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaaaq
    felaqklgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavsee
    gssvipeimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavtads
    iaqkadffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvria
    vtkgrrvkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikdrr
    aamkarkgfaakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6zA (A:)
    vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
    ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasdtvlnlglnkvtvdawvr
    raprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasdlkelc
    dgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgtavnvqa
    mvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhslslrwak
    ahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwllqcrn
    gkrtihaavriaidmvneglisreeavlridpyqvdhlmhpnlepgaekankpigrglaa
    spgaavgqvvfdaesakewsgrgkkvimvrletspedlagmdaacgiltarggmtshaav
    vargmgkccvsgcgdmvirgksfklngsvfregdyitidgskgliyagklklrspdlkgs
    fqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsrinfiremil
    adsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaaaqfelaqk
    lgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavseegssvip
    eimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavtadsiaqkad
    ffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvriavtkgrr
    vkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikdrraamk