PDB entry 1h6w

View 1h6w on RCSB PDB site
Description: crystal structure of a heat- and protease-stable fragment of the bacteriophage t4 short fibre
Deposited on 2001-06-28, released 2001-12-13
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-13, with a file datestamp of 2001-12-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22834
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6wA (A:)
    lsypnatesvygltrystndeaiagvnnessitpakftvalnnvfetrvstessngviki
    sslpqalagaddttamtplktqqlavkliaqiapsknaateseqgviqlatvaqarqgtl
    regyaispytfmnstateeykgviklgtqsevnsnnasvavtgatlngrgsttsmrgvvk
    ltttagsqsggdassalawnadvihqrggqtingtlrinntltiasgganitgtvnmtgg
    yiqgkrvvtqneidrtipvgaimmwaadslpsdawrfchggtvsasdcplyasrigtryg
    gsssnpglpdmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6wA (A:)
    tgatlngrgsttsmrgvvkltttagsqsggdassalawnadvihqrggqtingtlrinnt
    ltiasgganitgtvnmtggyiqgkrvvtqneidrtipvgaimmwaadslpsdawrfchgg
    tvsasdcplyasrigtryggsssnpglpdmr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6wB (B:)
    slnyiikvke