PDB entry 1h6m

View 1h6m on RCSB PDB site
Description: covalent glycosyl-enzyme intermediate of hen egg white lysozyme
Class: hydrolase (o-glycosyl)
Keywords: lysozyme, glycoside hydrolase, mechanism, covalent intermediate
Deposited on 2001-06-19, released 2001-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2001-08-30, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.17209
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: GALLUS GALLUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered mutation (34)
    Domains in SCOP 1.73: d1h6ma_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6mA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfqsnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl