PDB entry 1h6i

View 1h6i on RCSB PDB site
Description: a refined structure of human aquaporin 1
Deposited on 2001-06-15, released 2001-12-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-10, with a file datestamp of 2002-05-10.
Experiment type: EDIF
Resolution: 3.54 Å
R-factor: 0.364
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1h6ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h6iA (A:)
    lfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsvg
    hisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrnd
    ladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidytg
    cginparsfgsavithnfsnhwifwvgpfiggalavliydfilap