PDB entry 1h65

View 1h65 on RCSB PDB site
Description: crystal structure of pea toc34 - a novel gtpase of the chloroplast protein translocon
Class: gtpase
Keywords: gtpase, chloroplast, translocon
Deposited on 2001-06-06, released 2002-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroplast outer envelope protein oep34
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009 (Start-257)
      • modified residue (44)
      • modified residue (78)
      • modified residue (105)
    • PDB 1H65 (258-End)
    Domains in SCOPe 2.03: d1h65a_
  • Chain 'B':
    Compound: chloroplast outer envelope protein oep34
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009 (Start-257)
      • modified residue (44)
      • modified residue (78)
      • modified residue (105)
    • PDB 1H65 (258-End)
    Domains in SCOPe 2.03: d1h65b_
  • Chain 'C':
    Compound: chloroplast outer envelope protein oep34
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41009 (Start-257)
      • modified residue (44)
      • modified residue (78)
      • modified residue (105)
    • PDB 1H65 (258-End)
    Domains in SCOPe 2.03: d1h65c_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h65A (A:)
    masqqqtvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidklaaadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h65A (A:)
    vrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks
    esifvdknlidklaaad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h65B (B:)
    masqqqtvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidklaaadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h65B (B:)
    tvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
    ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
    drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
    qvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnk
    sesifvdknlidklaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h65C (C:)
    masqqqtvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsii
    gervvsispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldkti
    dvllyvdrldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffsk
    rseallqvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtit
    evalnksesifvdknlidklaaadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h65C (C:)
    vrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
    spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
    rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
    vvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks
    esifvdknlidklaaa