PDB entry 1h5b

View 1h5b on RCSB PDB site
Description: t cell receptor valpha11 (av11s5) domain
Deposited on 2001-05-21, released 2001-06-21
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-02, with a file datestamp of 2001-08-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.224
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h5ba_
  • Chain 'B':
    Domains in SCOP 1.71: d1h5bb_
  • Chain 'C':
    Domains in SCOP 1.71: d1h5bc_
  • Chain 'D':
    Domains in SCOP 1.71: d1h5bd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h5bA (A:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdserarystlhirdaqledsgtyfcaaeassgswqlifgsgtqltvmpvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h5bB (B:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmpvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h5bB (B:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h5bC (C:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdskerrystlhirdaqledsgtyfcaaeassgswqlifgsgtqltvmpvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h5bD (D:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmpvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h5bD (D:)
    gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
    safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp