PDB entry 1h4j

View 1h4j on RCSB PDB site
Description: methylobacterium extorquens methanol dehydrogenase d303e mutant
Deposited on 2001-05-11, released 2001-08-23
The last revision prior to the SCOP 1.71 freeze date was dated 2001-08-23, with a file datestamp of 2001-08-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.187
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h4ja_
  • Chain 'B':
    Domains in SCOP 1.71: d1h4jb_
  • Chain 'C':
    Domains in SCOP 1.71: d1h4jc_
  • Chain 'D':
    Domains in SCOP 1.71: d1h4jd_
  • Chain 'E':
    Domains in SCOP 1.71: d1h4je_
  • Chain 'F':
    Domains in SCOP 1.71: d1h4jf_
  • Chain 'G':
    Domains in SCOP 1.71: d1h4jg_
  • Chain 'H':
    Domains in SCOP 1.71: d1h4jh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4jA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h4jB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h4jC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h4jD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h4jE (E:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jE (E:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h4jF (F:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jF (F:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1h4jG (G:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jG (G:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1h4jH (H:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4jH (H:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakis