PDB entry 1h4i

View 1h4i on RCSB PDB site
Description: methylobacterium extorquens methanol dehydrogenase
Deposited on 2001-05-11, released 2001-06-14
The last revision prior to the SCOP 1.71 freeze date was dated 2001-06-14, with a file datestamp of 2001-06-14.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.1985
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1h4ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1h4ib_
  • Chain 'C':
    Domains in SCOP 1.71: d1h4ic_
  • Chain 'D':
    Domains in SCOP 1.71: d1h4id_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4iA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4iA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h4iB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4iB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h4iC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4iC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h4iD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4iD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisa